PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s925071g016
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRAS
Protein Properties Length: 701aa    MW: 79937.2 Da    PI: 9.3577
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s925071g016genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS306.18.4e-943106871373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lLl +A+a +++d + a  +L +l +++s +gdp+qR+aayft +Laarl+   s  y+++ + +t+    +ee++a++ ++++sP+++
  PDK_30s925071g016 310 LTHLLLVAATAADANDISSAVDALHELYDRVSLHGDPIQRVAAYFTDGLAARLLTGRSPFYRTIMAHPTP----EEEFSAFTQLYQASPYYQ 397
                        579****************************************************99*******999998....788999999********* PP

               GRAS  93 fshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpf 176
                        f+h+taNqaI ea+e+e     +r+H++Dfd+s+G+QWp+L+q+L++++  ++p slRi g+g+    s eel+et+ rLa+f + + ++ f
  PDK_30s925071g016 398 FAHFTANQAIIEAFEKEemkngRRLHVVDFDVSYGFQWPSLIQSLSDKAtgSKPISLRIMGFGR----SIEELKETETRLANFTKGCrNLIF 485
                        ****************978777789**********************99744455*********....9***************98648*** PP

               GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                        ef+ l    l+  + ++++++++ +l+Vnlv+ l++l  +s +      ++L ++ sl+P vvv+v +e + + +sFl rf+e+l+yy+a+f
  PDK_30s925071g016 486 EFEGL----LTGSRSSDFKIEKDATLVVNLVFYLQNLR-SSSE----VYDTLMAIHSLNPSVVVLVGKEGSQSPQSFLSRFTESLHYYAAMF 568
                        ****8....777788999******************97.3333....3459***************************************** PP

               GRAS 269 dsleaklpreseerikvErellgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllr......kvksdg.... 348
                        dsl+  lp+ s er ++E+  lgrei+ + ++e++e  +  r e+l +W++++e++GF++++ls++ ++qaklll+        + dg    
  PDK_30s925071g016 569 DSLNDCLPSGSVERLSIEKNHLGREIKTAMTNEEKEeeKHLRSERLDTWKRKMESFGFEEIKLSSTSVSQAKLLLKikshcsSLGHDGgagg 660
                        ********************************99874466799*******************************973332221122224445 PP

               GRAS 349 yrveee.sgslv.lgWkdrpLvsvSaW 373
                        +r+ e+ +g ++ lgW+dr L++vSaW
  PDK_30s925071g016 661 FRISERdEGRAIsLGWQDRLLTTVSAW 687
                        9*99773455557************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.763284656IPR005202Transcription factor GRAS
PfamPF035142.9E-91310687IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MAANCLPNLH DKQALNEDMI NRFGRISQRR EILVEFSIEI IFGAINISFT IPFCGLELRC  60
GRTPDRLEFR LWVIYNKTKQ HIRSHGILSL LSAIEVLEGT KKGWWLKREP LIKTKTIGKR  120
RTKQREENAT HRLNLGIQEE YRSKDKKKKK YQGKKISFIQ KSLYFIYMPK KAKPSPSSLP  180
LVTQRNFPYI SFLHFPYNSN YSFHCHLLHP LSSCASASAT QRETERERER MQEDIGEEMP  240
GLDLGIGSTW RSSTAEKRKQ RRGESNSMAC GTLMQDVLDK KFFGLLQARE RMLRADPRRN  300
GLEDGNRLQL THLLLVAATA ADANDISSAV DALHELYDRV SLHGDPIQRV AAYFTDGLAA  360
RLLTGRSPFY RTIMAHPTPE EEFSAFTQLY QASPYYQFAH FTANQAIIEA FEKEEMKNGR  420
RLHVVDFDVS YGFQWPSLIQ SLSDKATGSK PISLRIMGFG RSIEELKETE TRLANFTKGC  480
RNLIFEFEGL LTGSRSSDFK IEKDATLVVN LVFYLQNLRS SSEVYDTLMA IHSLNPSVVV  540
LVGKEGSQSP QSFLSRFTES LHYYAAMFDS LNDCLPSGSV ERLSIEKNHL GREIKTAMTN  600
EEKEEEKHLR SERLDTWKRK MESFGFEEIK LSSTSVSQAK LLLKIKSHCS SLGHDGGAGG  660
FRISERDEGR AISLGWQDRL LTTVSAWHCI RSPNHSPGCS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-443156878374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1145154KKKKKYQGKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008784262.10.0PREDICTED: scarecrow-like protein 3
TrEMBLM5VGL50.0M5VGL5_PRUPE; Uncharacterized protein
STRINGGSMUA_Achr10P09690_0011e-177(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP116493038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.16e-48SCARECROW-like 21